Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes.
| Attributes | Values |
|---|
| rdf:type
| |
| rdfs:label
| - Cecropin (en)
- Cekropiny (pl)
- Цекропін (uk)
|
| rdfs:comment
| - Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. (en)
- Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy . Peptydy te wyizolowano również od ssaków. Są to białka:
* zbudowane z 34-39 reszt aminokwasowych
* posiadają dwie α-helisy. Wyróżnia się cekropiny:
* cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK)
* cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL)
* cekropinę P1 (wyizolowana z jelita świń). (pl)
|
| name
| |
| foaf:depiction
| |
| dct:subject
| |
| Wikipage page ID
| |
| Wikipage revision ID
| |
| Link from a Wikipage to another Wikipage
| |
| Link from a Wikipage to an external page
| |
| sameAs
| |
| TCDB
| |
| dbp:wikiPageUsesTemplate
| |
| thumbnail
| |
| PROSITE
| |
| SCOP
| |
| caption
| - Model of Drosophila melanogaster Cecropin A (en)
|
| InterPro
| |
| Pfam
| |
| symbol
| |
| has abstract
| - Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. Cecropins constitute a main part of the innate immune system of insects. Cecropins are small proteins anywhere from 31 - 37 amino acids long and are active against both gram-positive and gram-negative bacteria. Cecropins isolated from insects other than Hyalophora cecropia (Cecropia moth) have been given various names, such as bactericidin, lepidopterin, and sarcotoxin. All of these peptides are structurally related. (en)
- Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy . Peptydy te wyizolowano również od ssaków. Są to białka:
* zbudowane z 34-39 reszt aminokwasowych
* posiadają dwie α-helisy. Wyróżnia się cekropiny:
* cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK)
* cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL)
* cekropinę P1 (wyizolowana z jelita świń). Cekropiny są aktywne wobec bakterii Gram-dodatnich i Gram-ujemnych. Zarówno cekropina A, jak i cekropina B wykazują właściwości cytolityczne w stosunku do kilku różnych linii komórek nowotworowych, przy czym nie powodują niszczenia prawidłowych komórek fibroblastów, limfocytów i erytrocytów. Suttman i wsp. wykazali, że cekropiny A i B wykazują dużą toksyczność względem komórek raka pęcherza moczowego z niewielkim efektem toksycznym w stosunku do komórek prawidłowych fibroblastów. Badania Madera wykazały, że skojarzenie cekropiny A z 5-fluorouracylem przynosi dodatkowy efekt cytotoksyczny przeciwko komórkom ostrej białaczki limfatycznej i może być zastosowana w terapii przeciwnowotworowej. (pl)
|
| OPM family
| |
| OPM protein
| |
| gold:hypernym
| |
| prov:wasDerivedFrom
| |
| page length (characters) of wiki page
| |
| Symbol
| |
| foaf:isPrimaryTopicOf
| |
| is Link from a Wikipage to another Wikipage
of | |
| is Wikipage redirect
of | |
| is foaf:primaryTopic
of | |
![[RDF Data]](/fct/images/sw-rdf-blue.png)
![[cxml]](/fct/images/cxml_doc.png)
![[csv]](/fct/images/csv_doc.png)
![[text]](/fct/images/ntriples_doc.png)
![[turtle]](/fct/images/n3turtle_doc.png)
![[ld+json]](/fct/images/jsonld_doc.png)
![[rdf+json]](/fct/images/json_doc.png)
![[rdf+xml]](/fct/images/xml_doc.png)
![[atom+xml]](/fct/images/atom_doc.png)
![[html]](/fct/images/html_doc.png)
